PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462927065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GATA
Protein Properties Length: 145aa    MW: 16291.7 Da    PI: 10.8526
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462927065genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.9e-1877111135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C ++kTp+WR gp g+ktLCnaCG+++++ +l
  462927065  77 CTHCMSSKTPQWRTGPMGPKTLCNACGVRFKSGRL 111
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.45171107IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-1771125IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.85E-1573134No hitNo description
Gene3DG3DSA:3.30.50.101.3E-1475109IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.90E-1376133No hitNo description
PROSITE patternPS00344077102IPR000679Zinc finger, GATA-type
PfamPF003209.3E-1677111IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MDVHPPNAAA NSLGDLFPHQ AALVKPENRF TTISEKQWGQ GTNKKQEHGK RRDKKKIKKT  60
PNAIERELPP EPPTRVCTHC MSSKTPQWRT GPMGPKTLCN ACGVRFKSGR LLPEYRPANS  120
PTFVSHIHSN SHKKVLQLRQ GDGHM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15058RRDKKKIKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBMTransfer from AT1G08000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963249.11e-51PREDICTED: GATA transcription factor 2-like
TrEMBLA0A0A9VSA12e-58A0A0A9VSA1_ARUDO; Uncharacterized protein
STRINGSi022727m4e-51(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.15e-35GATA transcription factor 2